Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens lactalbumin alpha (LALBA) (NM_002289). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P00709 |
| Entry Name | LALBA_HUMAN |
| Gene Names | LALBA LYZL7 |
| Alternative Gene Names | LYZL7 |
| Alternative Protein Names | Alpha-lactalbumin (Lactose synthase B protein) (Lysozyme-like protein 7) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 142 |
| Molecular Weight(Da) | 16225 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL |
Background
| Function | FUNCTION: Regulatory subunit of lactose synthase, changes the substrate specificity of galactosyltransferase in the mammary gland making glucose a good acceptor substrate for this enzyme. This enables LS to synthesize lactose, the major carbohydrate component of milk. In other tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of the oligosaccharide chains in glycoproteins. |
| Pathway | |
| Protein Families | Glycosyl hydrolase 22 family |
| Tissue Specificity | Mammary gland specific. Secreted in milk. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |