Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens L antigen family member 3 (LAGE3) (NM_006014). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q14657 |
| Entry Name | LAGE3_HUMAN |
| Gene Names | LAGE3 DXS9879E ESO3 ITBA2 |
| Alternative Gene Names | DXS9879E ESO3 ITBA2 |
| Alternative Protein Names | EKC/KEOPS complex subunit LAGE3 (L antigen family member 3) (Protein ESO-3) (Protein ITBA2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 143 |
| Molecular Weight(Da) | 14804 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR |
Background
| Function | FUNCTION: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. LAGE3 functions as a dimerization module for the complex. {ECO:0000305|PubMed:22912744, ECO:0000305|PubMed:27903914}. |
| Pathway | |
| Protein Families | CTAG/PCC1 family |
| Tissue Specificity | Ubiquitous. {ECO:0000269|PubMed:12384295, ECO:0000269|PubMed:8786131}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |