Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens keratinocyte differentiation associated protein (KRTDAP), transcript variant 1 (NM_207392). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P60985 |
| Entry Name | KTDAP_HUMAN |
| Gene Names | KRTDAP KDAP UNQ467/PRO826 |
| Alternative Gene Names | KDAP |
| Alternative Protein Names | Keratinocyte differentiation-associated protein |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 99 |
| Molecular Weight(Da) | 11050 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALFESIKRKLPFLNWDAFPKLKGLRSATPDAQ |
Background
| Function | FUNCTION: May act as a soluble regulator of keratinocyte differentiation. May play an important role in embryonic skin morphogenesis. {ECO:0000269|PubMed:15140226}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Highly expressed in skin and detected at lower levels in thymus. In skin, found exclusively in lamellar granules of granular keratinocytes and in the intracellular space of the stratum corneum. Also highly expressed in oral mucosa, tongue, esophagus, and stomach, and at much lower levels in bladder and uterus. Not detected in gastrointestinal mucosa. {ECO:0000269|PubMed:15140226}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |