Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens potassium voltage-gated channel subfamily E regulatory subunit 5 (KCNE5) (NM_012282). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9UJ90 |
| Entry Name | KCNE5_HUMAN |
| Gene Names | KCNE5 AMMECR2 KCNE1L |
| Alternative Gene Names | AMMECR2 KCNE1L |
| Alternative Protein Names | Potassium voltage-gated channel subfamily E regulatory beta subunit 5 (AMME syndrome candidate gene 2 protein) (Potassium channel subunit beta MiRP4) (Potassium voltage-gated channel subfamily E member 1-like protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 142 |
| Molecular Weight(Da) | 14993 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAEHEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAERV |
Background
| Function | FUNCTION: Potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Functions as an inhibitory beta-subunit of the repolarizing cardiac potassium ion channel KCNQ1. {ECO:0000269|PubMed:12324418}. |
| Pathway | |
| Protein Families | Potassium channel KCNE family |
| Tissue Specificity | Highly expressed in heart, skeletal muscle, brain, spinal cord and placenta. {ECO:0000269|PubMed:10493825}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |