Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens iron-sulfur cluster assembly 1 (ISCA1) (NM_030940). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | Q9BUE6 |
Entry Name | ISCA1_HUMAN |
Gene Names | ISCA1 HBLD2 GK004 |
Alternative Gene Names | HBLD2 |
Alternative Protein Names | Iron-sulfur cluster assembly 1 homolog, mitochondrial (HESB-like domain-containing protein 2) (Iron-sulfur assembly protein IscA) (hIscA) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 129 |
Molecular Weight(Da) | 14179 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI |
Background
Function | FUNCTION: Involved in the maturation of mitochondrial 4Fe-4S proteins functioning late in the iron-sulfur cluster assembly pathway. Probably involved in the binding of an intermediate of Fe/S cluster assembly. {ECO:0000269|PubMed:15262227, ECO:0000269|PubMed:22323289}. |
Pathway | |
Protein Families | HesB/IscA family |
Tissue Specificity | Detected in cerebellum, kidney and heart. {ECO:0000269|PubMed:15262227}. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |