Recombinant Human Insulin-like growth factor I(IGF1) (Active)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID P05019
Uniprot Entry Name
Gene Names IGF1
Alternative Names Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1
Expression Region Full Length of Mature Protein (49-118aa)
Molecular Weight 9.1 kDa
Endotoxin Less than 0.5 EU/µg as determined by LAL method.
Sequence GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Product Form Lyophilized powder (Lyophilized from a 0.2 μm Filtered 20 mM NaAc-Hac, pH 4.5)
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contains the N- and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids has 94% identity with mouse IGF-I and exhibits cross-species activity. IGF-1 binds IGF-IR, IGF-IIR, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF-1 expression is regulated by growth hormone. R3 IGF-1 is an 83 amino acid analog of IGF-1 comprising the complete human IGF-1 sequence with the substitution of an Arg (R) for the Glu(E) at position three, hence R3, and a 13 amino acid extension peptide at the N terminus. R3 IGF-1 has been produced with the purpose of increasing biological activity. R3 IGF-1 is significantly more potent than human IGF-I in vitro.
Function The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation
Involvement in disease Insulin-like growth factor I deficiency (IGF1 deficiency)
Subcellular Location Secreted
Protein Families Insulin family
Tissue Specificity
Pathway HIF-1signalingpathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$43.00
In stock
SKU
EB-CAPHU3826

Recombinant Human Insulin-like growth factor I(IGF1) (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Insulin-like growth factor I(IGF1) (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.