Recombinant Human HSDL1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens hydroxysteroid dehydrogenase like 1 (HSDL1), transcript variant 1 (NM_031463).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q3SXM5
Entry Name HSDL1_HUMAN
Gene Names HSDL1 SDR12C3
Alternative Gene Names SDR12C3
Alternative Protein Names Inactive hydroxysteroid dehydrogenase-like protein 1 (Short chain dehydrogenase/reductase family 12C member 3)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 330
Molecular Weight(Da) 37002
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA
Background
Function
Pathway
Protein Families Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Tissue Specificity Highly expressed in testis and ovary. Also detected in thyroid, spinal cord, adrenal gland, heart, placenta, skeletal muscle, small intestine, colon, spleen, prostate and pancreas. {ECO:0000269|PubMed:12153137, ECO:0000269|PubMed:19026618}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8743696

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HSDL1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.