Recombinant Human HSD17B14 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens hydroxysteroid 17-beta dehydrogenase 14 (HSD17B14) (NM_016246).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BPX1
Entry Name DHB14_HUMAN
Gene Names HSD17B14 DHRS10 SDR3 SDR47C1 UNQ502/PRO474
Alternative Gene Names DHRS10 SDR3 SDR47C1
Alternative Protein Names 17-beta-hydroxysteroid dehydrogenase 14 (17-beta-HSD 14) (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase DHRS10) (Dehydrogenase/reductase SDR family member 10) (Retinal short-chain dehydrogenase/reductase retSDR3) (Short chain dehydrogenase/reductase family 47C member 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 270
Molecular Weight(Da) 28317
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS
Background
Function FUNCTION: Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro). {ECO:0000269|PubMed:17067289}.
Pathway
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity Highly expressed in brain, placenta, liver and kidney. {ECO:0000269|PubMed:10800688, ECO:0000269|PubMed:17067289}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8856625

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HSD17B14 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.