Recombinant Human HS3ST5 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens heparan sulfate-glucosamine 3-sulfotransferase 5 (HS3ST5) (NM_153612).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8IZT8
Entry Name HS3S5_HUMAN
Gene Names HS3ST5 3OST5 HS3OST5
Alternative Gene Names 3OST5 HS3OST5
Alternative Protein Names Heparan sulfate glucosamine 3-O-sulfotransferase 5 (EC 2.8.2.23) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 5) (3-OST-5) (Heparan sulfate 3-O-sulfotransferase 5) (h3-OST-5)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 346
Molecular Weight(Da) 40408
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLFKQQAWLRQKLLVLGSLAVGSLLYLVARVGSLDRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLHEFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYGKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFHPFNQKFYQITGRTLNWP
Background
Function FUNCTION: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) to catalyze the transfer of a sulfo group to position 3 of glucosamine residues in heparan. Catalyzes the rate limiting step in the biosynthesis of heparan sulfate (HSact). This modification is a crucial step in the biosynthesis of anticoagulant heparan sulfate as it completes the structure of the antithrombin pentasaccharide binding site. Also generates GlcUA-GlcNS or IdoUA-GlcNS and IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry. {ECO:0000269|PubMed:12138164}.
Pathway
Protein Families Sulfotransferase 1 family
Tissue Specificity Highly expressed in skeletal muscle and fetal brain, and also found in adult brain, spinal cord, cerebellum and colon. {ECO:0000269|PubMed:12138164, ECO:0000269|PubMed:12740361}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8633155

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HS3ST5 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.