Recombinant Human HINT2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens histidine triad nucleotide binding protein 2 (HINT2) (NM_032593).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BX68
Entry Name HINT2_HUMAN
Gene Names HINT2
Alternative Gene Names
Alternative Protein Names Adenosine 5'-monophosphoramidase HINT2 (EC 3.9.1.-) (HINT-3) (HIT-17kDa) (Histidine triad nucleotide-binding protein 2, mitochondrial) (HINT-2) (PKCI-1-related HIT protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 163
Molecular Weight(Da) 17162
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG
Background
Function FUNCTION: Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (PubMed:16762638, PubMed:31990367). Hydrolyzes adenosine 5'-O-p-nitrophenylphosphoramidate (AMP-pNA) (PubMed:16762638). Hydrolyzes fluorogenic purine nucleoside tryptamine phosphoramidates in vitro (PubMed:31990367). May be involved in steroid biosynthesis (PubMed:18653718). May play a role in apoptosis (PubMed:16762638). {ECO:0000269|PubMed:16762638, ECO:0000269|PubMed:18653718, ECO:0000269|PubMed:31990367}.
Pathway
Protein Families HINT family
Tissue Specificity High expression in liver and pancreas. Expression is significantly down-regulated in hepatocellular carcinoma (HCC) patients. {ECO:0000269|PubMed:16762638}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8742655

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HINT2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.