Recombinant Human HES2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens hes family bHLH transcription factor 2 (HES2) (NM_019089).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9Y543
Entry Name HES2_HUMAN
Gene Names HES2 BHLHB40
Alternative Gene Names BHLHB40
Alternative Protein Names Transcription factor HES-2 (Class B basic helix-loop-helix protein 40) (bHLHb40) (Hairy and enhancer of split 2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 173
Molecular Weight(Da) 18470
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRAGDSSGPSAPAPAPASAPEPASAPVPSPPSPPCGPGLWRPW
Background
Function FUNCTION: Transcriptional repressor of genes that require a bHLH protein for their transcription. {ECO:0000250}.
Pathway
Protein Families
Tissue Specificity Expressed in placenta, pancreatic cancer, colon cancer with RER, cervical cancer, and in head and neck tumors. {ECO:0000269|PubMed:15254753}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8582255

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HES2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.