Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens hemoglobin subunit mu (HBM) (NM_001003938). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | Q6B0K9 |
Entry Name | HBM_HUMAN |
Gene Names | HBM HBAP2 |
Alternative Gene Names | HBAP2 |
Alternative Protein Names | Hemoglobin subunit mu (Hemoglobin mu chain) (Mu-globin) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 141 |
Molecular Weight(Da) | 15618 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKYR |
Background
Function | |
Pathway | |
Protein Families | Globin family |
Tissue Specificity | Expressed in erythroid tissues. {ECO:0000269|PubMed:15855277}. |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |