Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens H2A.B variant histone 2 (H2AB2) (NM_001017991). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P0C5Z0 |
| Entry Name | H2AB2_HUMAN |
| Gene Names | H2AB2 H2AFB2; H2AB3 H2ABBD H2AFB H2AFB3 |
| Alternative Gene Names | H2AFB2; H2ABBD H2AFB H2AFB3 |
| Alternative Protein Names | Histone H2A-Bbd type 2/3 (H2A Barr body-deficient) (H2A.Bbd) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 115 |
| Molecular Weight(Da) | 12713 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED |
Background
| Function | FUNCTION: Atypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. Nucleosomes containing this histone are less rigid and organize less DNA than canonical nucleosomes in vivo. They are enriched in actively transcribed genes and associate with the elongating form of RNA polymerase. They associate with spliceosome components and are required for mRNA splicing. May participate in spermatogenesis. {ECO:0000269|PubMed:15257289, ECO:0000269|PubMed:16287874, ECO:0000269|PubMed:16957777, ECO:0000269|PubMed:17591702, ECO:0000269|PubMed:17726088, ECO:0000269|PubMed:18329190, ECO:0000269|PubMed:22795134}. |
| Pathway | |
| Protein Families | Histone H2A family |
| Tissue Specificity | Present in mature sperm. {ECO:0000269|PubMed:20008104}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |