Recombinant Human GPX7 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens glutathione peroxidase 7 (GPX7) (NM_015696).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96SL4
Entry Name GPX7_HUMAN
Gene Names GPX7 GPX6 UNQ469/PRO828
Alternative Gene Names GPX6
Alternative Protein Names Glutathione peroxidase 7 (GPx-7) (GSHPx-7) (EC 1.11.1.9) (CL683)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 187
Molecular Weight(Da) 20996
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
Background
Function FUNCTION: It protects esophageal epithelia from hydrogen peroxide-induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks. {ECO:0000269|PubMed:22157330}.
Pathway
Protein Families Glutathione peroxidase family
Tissue Specificity Expressed in esophageal epithelial cells; expression is up-regulated after exposure to acidic bile acids. {ECO:0000269|PubMed:22157330}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8794155

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human GPX7 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.