Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens glycoprotein hormone alpha 2 (GPHA2) (NM_130769). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96T91 |
| Entry Name | GPHA2_HUMAN |
| Gene Names | GPHA2 GPA2 ZSIG51 |
| Alternative Gene Names | GPA2 ZSIG51 |
| Alternative Protein Names | Glycoprotein hormone alpha-2 (Putative secreted protein Zsig51) (Thyrostimulin subunit alpha) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 129 |
| Molecular Weight(Da) | 14163 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY |
Background
| Function | FUNCTION: Functions as a heterodimeric glycoprotein hormone with GPHB5 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production (PubMed:12045258). Plays a central role in controlling thyroid cell metabolism (PubMed:12045258). {ECO:0000269|PubMed:12045258}. |
| Pathway | |
| Protein Families | Glycoprotein hormones subunit alpha family |
| Tissue Specificity | Found in a variety of tissues. {ECO:0000269|PubMed:12089349}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |