Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens granulysin (GNLY), transcript variant 2 (NM_006433). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P22749 |
| Entry Name | GNLY_HUMAN |
| Gene Names | GNLY LAG2 NKG5 TLA519 |
| Alternative Gene Names | LAG2 NKG5 TLA519 |
| Alternative Protein Names | Granulysin (Lymphokine LAG-2) (Protein NKG5) (T-cell activation protein 519) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 145 |
| Molecular Weight(Da) | 16374 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL |
Background
| Function | FUNCTION: Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed in natural killer and T-cells. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |