Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens GABA type A receptor-associated protein (GABARAP) (NM_007278). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O95166 |
| Entry Name | GBRAP_HUMAN |
| Gene Names | GABARAP FLC3B HT004 |
| Alternative Gene Names | FLC3B |
| Alternative Protein Names | Gamma-aminobutyric acid receptor-associated protein (GABA(A) receptor-associated protein) (MM46) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 117 |
| Molecular Weight(Da) | 13918 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
Background
| Function | FUNCTION: Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton (PubMed:9892355). Involved in autophagy: while LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed:15169837, PubMed:20562859, PubMed:22948227). Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538). Also required for the local activition of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, regulating ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor (GEF) that activates RAC1 and downstream signal transduction (PubMed:25684205). Thereby, regulates different biological processes including the organization of the cytoskeleton, cell migration and proliferation (PubMed:25684205). Involved in apoptosis (PubMed:15977068). {ECO:0000269|PubMed:15169837, ECO:0000269|PubMed:15977068, ECO:0000269|PubMed:20562859, ECO:0000269|PubMed:22948227, ECO:0000269|PubMed:25684205, ECO:0000269|PubMed:31006538, ECO:0000269|PubMed:9892355}. |
| Pathway | |
| Protein Families | ATG8 family |
| Tissue Specificity | Heart, brain, placenta, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:11146101, ECO:0000269|PubMed:9892355}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |