Recombinant Human FOPNL protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens centrosomal protein 20 (CEP20), transcript variant 1 (NM_144600).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96NB1
Entry Name CEP20_HUMAN
Gene Names CEP20 C16orf63 FOPNL FOR20 PHSECRG2
Alternative Gene Names C16orf63 FOPNL FOR20 PHSECRG2
Alternative Protein Names Centrosomal protein 20 (FGFR1OP N-terminal-like protein) (FOP-related protein of 20 kDa) (LisH domain-containing protein FOPNL)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 174
Molecular Weight(Da) 19778
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR
Background
Function FUNCTION: Involved in the biogenesis of cilia (PubMed:20551181). Required for the recruitment of PLK1 to centrosomes and S phase progression (PubMed:24018379). {ECO:0000269|PubMed:20551181, ECO:0000269|PubMed:24018379}.
Pathway
Protein Families CEP43 family
Tissue Specificity Widely expressed. Detected in brain, heart, kidney, liver, lung, skeletal muscle, placenta and intestine. {ECO:0000269|PubMed:20551181}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8761715

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FOPNL protein
Copyright © 2021-present Echo Biosystems. All rights reserved.