Recombinant Human FKBP11 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens FKBP prolyl isomerase 11 (FKBP11), transcript variant 1 (NM_016594).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NYL4
Entry Name FKB11_HUMAN
Gene Names FKBP11 FKBP19 UNQ336/PRO535
Alternative Gene Names FKBP19
Alternative Protein Names Peptidyl-prolyl cis-trans isomerase FKBP11 (PPIase FKBP11) (EC 5.2.1.8) (19 kDa FK506-binding protein) (19 kDa FKBP) (FKBP-19) (FK506-binding protein 11) (FKBP-11) (Rotamase)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 201
Molecular Weight(Da) 22180
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
Background
Function FUNCTION: PPIases accelerate the folding of proteins during protein synthesis.
Pathway
Protein Families FKBP-type PPIase family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8850746

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FKBP11 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.