Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | Tag-Free |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P05230 |
| Uniprot Entry Name | |
| Gene Names | FGF1 |
| Alternative Names | Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Endothelial Cell Growth Factor; ECGFHeparin-Binding Growth Factor 1; HBGF-1; FGF1; FGFA |
| Expression Region | Full Length of Mature Protein (16-155aa) |
| Molecular Weight | 15.9 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm Filtered 20 mM Tris, 400 mM NaCl, 1 mM DTT, pH 8.0) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | FGF acidic, also known as ECGF, FGF-1and HBGF-1, is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. It is a mitogenic peptide that is produced by multiple cell types and stimulates the proliferation of cells of mesodermal, ectodermal, and endodermal origin. Its association with heparan sulfate is a prerequisite for activation of FGF receptors. Internalized FGF acidic migrates to the nucleus where it is phosphorylated by nuclear PKC delta, exported to the cytosol, dephosphorylated, and degraded. Intracellular FGF acidic inhibits p53 activity and proapoptotic signaling. |
| Function | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV |
| Involvement in disease | |
| Subcellular Location | Secreted, Cytoplasm, Cytoplasm, cell cortex, Cytoplasm, cytosol, Nucleus |
| Protein Families | Heparin-binding growth factors family |
| Tissue Specificity | Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle. |
| Pathway | Hipposignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |