Recombinant Human FAM3B protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens FAM3 metabolism regulating signaling molecule B (FAM3B), transcript variant 1 (NM_058186).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P58499
Entry Name FAM3B_HUMAN
Gene Names FAM3B C21orf11 C21orf76 PRED44 UNQ320/PRO365
Alternative Gene Names C21orf11 C21orf76
Alternative Protein Names Protein FAM3B (Cytokine-like protein 2-21) (Pancreatic-derived factor) (PANDER)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 235
Molecular Weight(Da) 25982
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Background
Function FUNCTION: Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. {ECO:0000269|PubMed:16114871}.
Pathway
Protein Families FAM3 family
Tissue Specificity Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis. {ECO:0000269|PubMed:16114871}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8780696

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human FAM3B protein
Copyright © 2021-present Echo Biosystems. All rights reserved.