Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens family with sequence similarity 32 member A (FAM32A) (NM_014077). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y421 |
| Entry Name | FA32A_HUMAN |
| Gene Names | FAM32A OTAG12 CGI-144 |
| Alternative Gene Names | OTAG12 |
| Alternative Protein Names | Protein FAM32A (Ovarian tumor-associated gene 12) (OTAG-12) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 112 |
| Molecular Weight(Da) | 13178 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK |
Background
| Function | FUNCTION: Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli. {ECO:0000269|PubMed:21339736}. |
| Pathway | |
| Protein Families | FAM32 family |
| Tissue Specificity | Expressed in ovary, with isoform 1 being predominant. {ECO:0000269|PubMed:21339736}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |