Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens fatty acid binding protein 2 (FABP2) (NM_000134). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P12104 |
| Entry Name | FABPI_HUMAN |
| Gene Names | FABP2 FABPI |
| Alternative Gene Names | FABPI |
| Alternative Protein Names | Fatty acid-binding protein, intestinal (Fatty acid-binding protein 2) (Intestinal-type fatty acid-binding protein) (I-FABP) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 132 |
| Molecular Weight(Da) | 15207 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
Background
| Function | FUNCTION: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor. |
| Pathway | |
| Protein Families | Calycin superfamily, Fatty-acid binding protein (FABP) family |
| Tissue Specificity | Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum. {ECO:0000269|PubMed:14563446}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |