Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal Fc-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P20827 |
| Uniprot Entry Name | |
| Gene Names | EFNA1 |
| Alternative Names | Ephrin-A1; EPH-Related Receptor Tyrosine Kinase Ligand 1; LERK-1; Immediate Early Response Protein B61; Tumor Necrosis Factor Alpha-Induced Protein 4; TNF Alpha-Induced Protein 4; EFNA1; EPLG1; LERK1; TNFAIP4 |
| Expression Region | Full Length of Mature Protein (19-182aa) |
| Molecular Weight | 46.5 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4) |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Background
| Relevance | Ephrin-A1 is a member of the A-type ephrin family of cell surface proteins that function as ligands for the A-type Eph receptor tyrosine kinase family. Ephrin-A1 can be induced by TNF and IL1B. Its expression levels can be down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells. Soluble Ephrin-A1 is necessary for the transformation of HeLa and SK-BR3 cells and participates in the relocalization of EPHA2 away from sites of cell-cell contact during transformation. Ephrin-A1 plays an important role in angiogenesis and tumor neovascularization. |
| Function | Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis. |
| Involvement in disease | |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Ephrin-A1, secreted form: Secreted |
| Protein Families | Ephrin family |
| Tissue Specificity | Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level). |
| Pathway | MAPKsignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |