Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens eukaryotic translation initiation factor 1A Y-linked (EIF1AY), transcript variant 1 (NM_004681). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O14602 |
| Entry Name | IF1AY_HUMAN |
| Gene Names | EIF1AY |
| Alternative Gene Names | |
| Alternative Protein Names | Eukaryotic translation initiation factor 1A, Y-chromosomal (eIF-1A Y isoform) (Eukaryotic translation initiation factor 4C) (eIF-4C) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 144 |
| Molecular Weight(Da) | 16442 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
Background
| Function | FUNCTION: Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity). {ECO:0000250}. |
| Pathway | |
| Protein Families | EIF-1A family |
| Tissue Specificity | Ubiquitous. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |