Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens epididymal protein 3B (EDDM3B) (NM_022360). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P56851 |
| Entry Name | EP3B_HUMAN |
| Gene Names | EDDM3B FAM12B HE3B UNQ6412/PRO21187 |
| Alternative Gene Names | FAM12B HE3B |
| Alternative Protein Names | Epididymal secretory protein E3-beta (Human epididymis-specific protein 3-beta) (HE3-beta) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 147 |
| Molecular Weight(Da) | 17584 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MASSLKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLKMVEPIGN |
Background
| Function | FUNCTION: Possible function in sperm maturation. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Epididymis. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |