Recombinant Human DUSP18 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens dual specificity phosphatase 18 (DUSP18), transcript variant 2 (NM_152511).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8NEJ0
Entry Name DUS18_HUMAN
Gene Names DUSP18 LMWDSP20
Alternative Gene Names LMWDSP20
Alternative Protein Names Dual specificity protein phosphatase 18 (EC 3.1.3.16) (EC 3.1.3.48) (Low molecular weight dual specificity phosphatase 20) (LMW-DSP20)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 188
Molecular Weight(Da) 21066
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
Background
Function FUNCTION: Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine. In vitro, dephosphorylates p-nitrophenyl phosphate (pNPP). {ECO:0000269|PubMed:12408986, ECO:0000269|PubMed:12591617}.
Pathway
Protein Families Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Tissue Specificity Widely expressed with highest levels in liver, brain, ovary and testis. {ECO:0000269|PubMed:12408986, ECO:0000269|PubMed:12591617}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8831405

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DUSP18 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.