Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 10xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q02127 |
Gene Names | DHODH |
Alternative Names | Dihydroorotate oxidase |
Expression Region | Partial(31-395aa ) |
Molecular Weight | 45.1 kDa |
Protein Sequence | TGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. |
Involvement in Disease | Postaxial acrofacial dysostosis (POADS) |
Subcellular Location | Mitochondrion inner membrane, Single-pass membrane protein |
Protein Families | Dihydroorotate dehydrogenase family, Type 2 subfamily |
Tissue Specificity | DHODH |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |