Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens defensin beta 121 (DEFB121), transcript variant 1 (NM_001011878). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q5J5C9 |
| Entry Name | DB121_HUMAN |
| Gene Names | DEFB121 DEFB21 |
| Alternative Gene Names | DEFB21 |
| Alternative Protein Names | Beta-defensin 121 (Beta-defensin 21) (DEFB-21) (Defensin, beta 121) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 76 |
| Molecular Weight(Da) | 8456 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV |
Background
| Function | FUNCTION: Has antibacterial activity. {ECO:0000305}. |
| Pathway | |
| Protein Families | Beta-defensin family |
| Tissue Specificity | Abundant expression in the male reproductive tract only. {ECO:0000269|PubMed:15772680}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |