Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens defensin alpha 6 (DEFA6) (NM_001926). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q01524 |
| Entry Name | DEF6_HUMAN |
| Gene Names | DEFA6 DEF6 |
| Alternative Gene Names | DEF6 |
| Alternative Protein Names | Defensin-6 (Defensin, alpha 6) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 100 |
| Molecular Weight(Da) | 10975 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL |
Background
| Function | FUNCTION: Has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. May protect cells against infection with HIV-1. {ECO:0000269|PubMed:15616305, ECO:0000269|PubMed:17088326}. |
| Pathway | |
| Protein Families | Alpha-defensin family |
| Tissue Specificity | Paneth cells of the small intestine. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |