Recombinant Human DEFA6 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens defensin alpha 6 (DEFA6) (NM_001926).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q01524
Entry Name DEF6_HUMAN
Gene Names DEFA6 DEF6
Alternative Gene Names DEF6
Alternative Protein Names Defensin-6 (Defensin, alpha 6)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 100
Molecular Weight(Da) 10975
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Background
Function FUNCTION: Has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. May protect cells against infection with HIV-1. {ECO:0000269|PubMed:15616305, ECO:0000269|PubMed:17088326}.
Pathway
Protein Families Alpha-defensin family
Tissue Specificity Paneth cells of the small intestine.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8801115

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DEFA6 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.