Recombinant Human DAP protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens death associated protein (DAP), transcript variant 2 (NM_004394).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P51397
Entry Name DAP1_HUMAN
Gene Names DAP DAP1
Alternative Gene Names DAP1
Alternative Protein Names Death-associated protein 1 (DAP-1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 102
Molecular Weight(Da) 11165
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Background
Function FUNCTION: Negative regulator of autophagy. Involved in mediating interferon-gamma-induced cell death. {ECO:0000269|PubMed:20537536}.
Pathway
Protein Families
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8715715

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DAP protein
Copyright © 2021-present Echo Biosystems. All rights reserved.