Recombinant Human CYBC1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens cytochrome b-245 chaperone 1 (CYBC1), transcript variant 2 (NM_001033046).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9BQA9
Entry Name CYBC1_HUMAN
Gene Names CYBC1 C17orf62 EROS
Alternative Gene Names C17orf62 EROS
Alternative Protein Names Cytochrome b-245 chaperone 1 (Essential for reactive oxygen species protein) (Eros)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 187
Molecular Weight(Da) 20774
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAIFDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS
Background
Function FUNCTION: Functions as a chaperone necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 heterodimer (PubMed:30361506). Controls the phagocyte respiratory burst and is essential for innate immunity (By similarity). {ECO:0000250|UniProtKB:Q3TYS2, ECO:0000269|PubMed:30361506}.
Pathway
Protein Families CYBC1 family
Tissue Specificity Highly expressed in macrophages, neutrophils and monocytes. {ECO:0000269|PubMed:28351984}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8679277

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CYBC1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.