Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens C-X-C motif chemokine ligand 14 (CXCL14) (NM_004887). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O95715 |
| Entry Name | CXL14_HUMAN |
| Gene Names | CXCL14 MIP2G NJAC SCYB14 PSEC0212 UNQ240/PRO273 |
| Alternative Gene Names | MIP2G NJAC SCYB14 |
| Alternative Protein Names | C-X-C motif chemokine 14 (Chemokine BRAK) (MIP-2G) (Small-inducible cytokine B14) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 111 |
| Molecular Weight(Da) | 13078 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Background
| Function | FUNCTION: Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays. {ECO:0000269|PubMed:10049774, ECO:0000269|PubMed:10946286}. |
| Pathway | |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Tissue Specificity | Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes. {ECO:0000269|PubMed:10049774, ECO:0000269|PubMed:10854217, ECO:0000269|PubMed:10946286}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |