Recombinant Human CRISP3 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens cysteine rich secretory protein 3 (CRISP3), transcript variant 2 (NM_001190986).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P54108
Entry Name CRIS3_HUMAN
Gene Names CRISP3
Alternative Gene Names
Alternative Protein Names Cysteine-rich secretory protein 3 (CRISP-3) (Specific granule protein of 28 kDa) (SGP28)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 245
Molecular Weight(Da) 27630
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY
Background
Function
Pathway
Protein Families CRISP family
Tissue Specificity Salivary gland, pancreas and prostate > epididymis, ovary, thymus and colon.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8848337

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CRISP3 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.