Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens cytochrome c oxidase assembly factor COX16 (COX16), transcript variant 1 (NM_016468). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9P0S2 |
| Entry Name | COX16_HUMAN |
| Gene Names | COX16 C14orf112 HSPC203 PTD019 |
| Alternative Gene Names | C14orf112 |
| Alternative Protein Names | Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (hCOX16) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 106 |
| Molecular Weight(Da) | 12293 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT |
Background
| Function | FUNCTION: Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase (PubMed:29355485, PubMed:29381136). Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2) (PubMed:29355485, PubMed:29381136). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6 (PubMed:29381136). Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines (PubMed:29381136). {ECO:0000269|PubMed:29355485, ECO:0000269|PubMed:29381136}. |
| Pathway | |
| Protein Families | COX16 family |
| Tissue Specificity | Widely expressed. Expressed at higher level in skeletal muscle, heart and liver. {ECO:0000269|PubMed:29355485}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |