Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens C-X9-C motif containing 1 (CMC1), transcript variant 4 (NM_182523). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | Q7Z7K0 |
Entry Name | COXM1_HUMAN |
Gene Names | CMC1 C3orf68 |
Alternative Gene Names | C3orf68 |
Alternative Protein Names | COX assembly mitochondrial protein homolog (Cmc1p) |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 106 |
Molecular Weight(Da) | 12490 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM |
Background
Function | FUNCTION: Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. {ECO:0000250}. |
Pathway | |
Protein Families | CMC family |
Tissue Specificity |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |