Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens CDGSH iron sulfur domain 2 (CISD2) (NM_001008388). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8N5K1 |
| Entry Name | CISD2_HUMAN |
| Gene Names | CISD2 CDGSH2 ERIS ZCD2 |
| Alternative Gene Names | CDGSH2 ERIS ZCD2 |
| Alternative Protein Names | CDGSH iron-sulfur domain-containing protein 2 (Endoplasmic reticulum intermembrane small protein) (MitoNEET-related 1 protein) (Miner1) (Nutrient-deprivation autophagy factor-1) (NAF-1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 135 |
| Molecular Weight(Da) | 15278 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV |
Background
| Function | FUNCTION: Regulator of autophagy that contributes to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca(2+) stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy. {ECO:0000269|PubMed:17846994, ECO:0000269|PubMed:20010695}. |
| Pathway | |
| Protein Families | CISD protein family, CISD2 subfamily |
| Tissue Specificity | Testis, small intestine, kidney, lung, brain, heart, pancreas and platelets. {ECO:0000269|PubMed:17846994}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |