Recombinant Human CGGBP1 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens CGG triplet repeat binding protein 1 (CGGBP1), transcript variant 2 (NM_003663).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9UFW8
Entry Name CGBP1_HUMAN
Gene Names CGGBP1 CGGBP
Alternative Gene Names CGGBP
Alternative Protein Names CGG triplet repeat-binding protein 1 (CGG-binding protein 1) (20 kDa CGG-binding protein) (p20-CGGBP DNA-binding protein)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 167
Molecular Weight(Da) 18820
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Background
Function FUNCTION: Binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. May play a role in regulating FMR1 promoter. {ECO:0000269|PubMed:9201980}.
Pathway
Protein Families
Tissue Specificity Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain. {ECO:0000269|PubMed:14667814}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8621618

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CGGBP1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.