Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens cadherin related family member 2 (CDHR2), transcript variant 2 (NM_017675). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9BYE9 |
| Entry Name | CDHR2_HUMAN |
| Gene Names | CDHR2 PCDH24 PCLKC |
| Alternative Gene Names | PCDH24 PCLKC |
| Alternative Protein Names | Cadherin-related family member 2 (Protocadherin LKC) (PC-LKC) (Protocadherin-24) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 1310 |
| Molecular Weight(Da) | 141543 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) CVRKSYNRKLQAMKAAKEARKTAAGVMPSAPAIPGTNMYNTERANPMLNLPNKDLGLEYLSPSNDLDSVSVNSLDDNSVDVDKNSQEIKEHRPPHTPPEPDPEPLSVVLLGRQAGASGQLEGPSYTNAGLDTTDL |
Background
| Function | FUNCTION: Intermicrovillar adhesion molecule that forms, via its extracellular domain, calcium-dependent heterophilic complexes with CDHR5 on adjacent microvilli. Thereby, controls the packing of microvilli at the apical membrane of epithelial cells. Through its cytoplasmic domain, interacts with microvillus cytoplasmic proteins to form the intermicrovillar adhesion complex/IMAC. This complex plays a central role in microvilli and epithelial brush border differentiation (PubMed:24725409). May also play a role in cell-cell adhesion and contact inhibition in epithelial cells (PubMed:12117771). {ECO:0000269|PubMed:12117771, ECO:0000269|PubMed:24725409}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Highly expressed in liver, kidney and colon. Moderately expressed in small intestine. Down-regulated in a number of liver and colon cancers (PubMed:12117771, PubMed:15534908). Expressed in duodenum with higher expression in enterocytes along the villus axis and lower expression in crypts (at protein level) (PubMed:24725409). {ECO:0000269|PubMed:12117771, ECO:0000269|PubMed:15534908, ECO:0000269|PubMed:24725409}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
