Specification
Description | Recombinant protein from the full-length sequence of Homo sapiens C-C motif chemokine ligand 3 like 1 (CCL3L1), transcript variant 1 (NM_021006). |
Organism | Homo sapiens (Human) |
Expression Host | Human Cells |
Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
Purity | Greater than 90% by SDS-PAGE gel |
Uniprot ID | P16619 |
Entry Name | CL3L1_HUMAN |
Gene Names | CCL3L1 D17S1718 G0S19-2 SCYA3L1; CCL3L3 |
Alternative Gene Names | D17S1718 G0S19-2 SCYA3L1; |
Alternative Protein Names | C-C motif chemokine 3-like 1 (G0/G1 switch regulatory protein 19-2) (LD78-beta(1-70)) (PAT 464.2) (Small-inducible cytokine A3-like 1) (Tonsillar lymphocyte LD78 beta protein) [Cleaved into: LD78-beta(3-70); LD78-beta(5-70)] |
Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
Length | 93 |
Molecular Weight(Da) | 10161 |
Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA |
Background
Function | FUNCTION: Chemotactic for lymphocytes and monocytes. Is a ligand for CCR1, CCR3 and CCR5. Is an inhibitor of HIV-1-infection. The processed form LD78-beta(3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. LD78-beta(3-70) is also a ligand for CCR1, CCR3 and CCR5. {ECO:0000269|PubMed:10961862, ECO:0000269|PubMed:11449371}. |
Pathway | |
Protein Families | Intercrine beta (chemokine CC) family |
Tissue Specificity |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |