Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens C-C motif chemokine ligand 27 (CCL27) (NM_006664). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y4X3 |
| Entry Name | CCL27_HUMAN |
| Gene Names | CCL27 ILC SCYA27 |
| Alternative Gene Names | ILC SCYA27 |
| Alternative Protein Names | C-C motif chemokine 27 (CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 112 |
| Molecular Weight(Da) | 12618 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG |
Background
| Function | FUNCTION: Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10. |
| Pathway | |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | Testis, thymus, placenta, ovary and skin. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |