Recombinant Human CARD18 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens caspase recruitment domain family member 18 (CARD18) (NM_021571).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P57730
Entry Name CAR18_HUMAN
Gene Names CARD18 ICEBERG UNQ5804/PRO19611
Alternative Gene Names ICEBERG
Alternative Protein Names Caspase recruitment domain-containing protein 18 (Caspase-1 inhibitor Iceberg)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 90
Molecular Weight(Da) 10138
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Background
Function FUNCTION: Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B. {ECO:0000269|PubMed:11051551}.
Pathway
Protein Families
Tissue Specificity Primarily expressed in the heart and placenta. {ECO:0000269|PubMed:11051551}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8753365

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CARD18 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.