Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens caspase recruitment domain family member 18 (CARD18) (NM_021571). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P57730 |
| Entry Name | CAR18_HUMAN |
| Gene Names | CARD18 ICEBERG UNQ5804/PRO19611 |
| Alternative Gene Names | ICEBERG |
| Alternative Protein Names | Caspase recruitment domain-containing protein 18 (Caspase-1 inhibitor Iceberg) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 90 |
| Molecular Weight(Da) | 10138 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH |
Background
| Function | FUNCTION: Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B. {ECO:0000269|PubMed:11051551}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Primarily expressed in the heart and placenta. {ECO:0000269|PubMed:11051551}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |