Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | C-terminal 6xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | Q8N1Q1 |
| Uniprot Entry Name | |
| Gene Names | CA13 |
| Alternative Names | Carbonic Anhydrase 13; Carbonate Dehydratase XIII; Carbonic Anhydrase XIII; CA-XIII; CA13 |
| Expression Region | Full Length (1-262aa) |
| Molecular Weight | 30.51 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH |
| Product Form | Liquid (0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5) |
| Reconstitution |
Background
| Relevance | Carbonic Anhydrase 13 (CA13) belongs to the carbonic anhydrase family which can catalyzes the reversible hydration recation of carbon dioxide. Carbonic anhydrases participate in many biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA13 is a cytosolic enzyme and is widely expressed in human, such as thymus, small intestine, spleen, prostate, ovary, colon and testis, indicating that it may play a key role in several organs. CA13 is inhibited by acetazolamide. |
| Function | Reversible hydration of carbon dioxide. |
| Involvement in disease | |
| Subcellular Location | |
| Protein Families | Alpha-carbonic anhydrase family |
| Tissue Specificity | Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis. |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
