Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens chromosome 4 open reading frame 46 (C4orf46), transcript variant 1 (NM_001008393). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q504U0 |
| Entry Name | CD046_HUMAN |
| Gene Names | C4orf46 RCDG1 |
| Alternative Gene Names | RCDG1 |
| Alternative Protein Names | Renal cancer differentiation gene 1 protein |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 113 |
| Molecular Weight(Da) | 11899 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD |
Background
| Function | |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Expressed in the kidney, in epithelial cells in both proximal tubules and distal convoluted tubules. {ECO:0000269|PubMed:25059753}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |