Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens chromosome 18 open reading frame 32 (C18orf32), transcript variant 2 (NM_001035005). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8TCD1 |
| Entry Name | CR032_HUMAN |
| Gene Names | C18orf32 |
| Alternative Gene Names | |
| Alternative Protein Names | UPF0729 protein C18orf32 (Putative NF-kappa-B-activating protein 200) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 76 |
| Molecular Weight(Da) | 8669 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKD |
Background
| Function | FUNCTION: May activate the NF-kappa-B signaling pathway. {ECO:0000269|PubMed:12761501}. |
| Pathway | |
| Protein Families | UPF0729 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |