Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens chromosome 12 open reading frame 57 (C12orf57), transcript variant 1 (NM_138425). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q99622 |
| Entry Name | C10_HUMAN |
| Gene Names | C12orf57 C10 |
| Alternative Gene Names | C10 |
| Alternative Protein Names | Protein C10 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 126 |
| Molecular Weight(Da) | 13178 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS |
Background
| Function | FUNCTION: In brain, may be required for corpus callosum development. {ECO:0000269|PubMed:23453666}. |
| Pathway | |
| Protein Families | UPF0456 family |
| Tissue Specificity | Ubiquitously expressed, with higher expression in lung and fetal brain. {ECO:0000269|PubMed:23453666}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |