Recombinant Human C11orf88 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens chromosome 11 open reading frame 88 (C11orf88), transcript variant 1 (NM_207430).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q6PI97
Entry Name HOATZ_HUMAN
Gene Names HOATZ C11orf88 HOATZIN
Alternative Gene Names C11orf88 HOATZIN
Alternative Protein Names Cilia- and flagella-associated protein HOATZ
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 169
Molecular Weight(Da) 19340
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKAKTREEILQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLD
Background
Function FUNCTION: Required for motile ciliogenesis and flagellar genesis by mediating the maturation of the glycolytic enzyme ENO4. {ECO:0000250|UniProtKB:Q80Y73}.
Pathway
Protein Families HOATZ family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8643876

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human C11orf88 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.