Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens binder of sperm protein homolog 1 (BSPH1) (NM_001128326). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q075Z2 |
| Entry Name | BSPH1_HUMAN |
| Gene Names | BSPH1 |
| Alternative Gene Names | |
| Alternative Protein Names | Binder of sperm protein homolog 1 (Bovine seminal plasma protein homolog 1) (Bovine seminal plasma protein-like 1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 132 |
| Molecular Weight(Da) | 15693 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MGSLMLLFVETTRNSSACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTYEGYWKFCSAEDFANCVFPFWYRRLIYWECTDDGEAFGKKWCSLTKNFNKDRIWKYCE |
Background
| Function | FUNCTION: Binds sperm in vitro and promotes sperm capacitation. Specifically promotes capacitation induced by high density lipoproteins (HDLs). Also binds heparin, phospholipid liposomes, and weakly to gelatin. Does not bind chondroitin sulfate B. {ECO:0000250|UniProtKB:Q3UW26}. |
| Pathway | |
| Protein Families | Seminal plasma protein family |
| Tissue Specificity | Expressed only in the epididymis. {ECO:0000269|PubMed:17085770}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |