Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens basic charge, Y-linked, 2C (BPY2C) (NM_001002761). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O14599 |
| Entry Name | VCY2_HUMAN |
| Gene Names | BPY2 BPY2A VCY2 VCY2A; BPY2B VCY2B; BPY2C VCY2C |
| Alternative Gene Names | BPY2A VCY2 VCY2A; VCY2B; VCY2C |
| Alternative Protein Names | Testis-specific basic protein Y 2 (Basic charge, Y-linked 2) (Variably charged protein Y 2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 106 |
| Molecular Weight(Da) | 12063 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK |
Background
| Function | |
| Pathway | |
| Protein Families | VCX/VCY family |
| Tissue Specificity | Expressed exclusively in testis. Expressed in ejaculated spermatozoa of germ cell. Expressed in the nuclei of spermatogonia, spermatocytes, and round spermatids, except elongated spermatids (at protein level). {ECO:0000269|PubMed:12207887, ECO:0000269|PubMed:12724276, ECO:0000269|PubMed:14627543}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |