Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens bolA family member 1 (BOLA1), transcript variant 3 (NM_016074). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y3E2 |
| Entry Name | BOLA1_HUMAN |
| Gene Names | BOLA1 CGI-143 |
| Alternative Gene Names | |
| Alternative Protein Names | BolA-like protein 1 (hBolA) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 137 |
| Molecular Weight(Da) | 14289 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP |
Background
| Function | FUNCTION: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins (By similarity). Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). {ECO:0000250|UniProtKB:Q3E793, ECO:0000269|PubMed:22746225, ECO:0000305|PubMed:27532772}. |
| Pathway | |
| Protein Families | BolA/IbaG family |
| Tissue Specificity | Widely expressed. {ECO:0000269|PubMed:18548201}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |