Recombinant Human BOLA1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens bolA family member 1 (BOLA1), transcript variant 3 (NM_016074).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9Y3E2
Entry Name BOLA1_HUMAN
Gene Names BOLA1 CGI-143
Alternative Gene Names
Alternative Protein Names BolA-like protein 1 (hBolA)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 137
Molecular Weight(Da) 14289
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
Background
Function FUNCTION: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins (By similarity). Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). {ECO:0000250|UniProtKB:Q3E793, ECO:0000269|PubMed:22746225, ECO:0000305|PubMed:27532772}.
Pathway
Protein Families BolA/IbaG family
Tissue Specificity Widely expressed. {ECO:0000269|PubMed:18548201}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8842355

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human BOLA1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.